IGF-1 DES Pen certificate of analysis, lot PL-2610-104
Certificate PL-26-00218 reports the release tests for IGF-1 DES Pen lot PL-2610-104: 99.46% purity by reverse-phase HPLC and identity confirmed by LC-MS, tested October 6, 2026. The lot number printed on each unit matches this certificate.
| Certificate number | PL-26-00218 |
|---|---|
| Lot number | PL-2610-104 |
| Compound | IGF-1 DES Pen 3 mg |
| Sequence | H-TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA-OH (67 residues; three intrachain disulfides; free N- and C-termini) |
| Molecular formula | C 319 H 501 N 91 O 96 S 7 (reduced-chain calculation) |
| CAS number | 112603-35-7 |
| Purity (RP-HPLC) | 99.46% |
| Identity (LC-MS) | Conforms (7,365.67 Da) · expected 7365.4 Da, found 7365.67 Da |
| Method | RP-HPLC (UV 214 nm) + LC-MS |
| Tested | October 6, 2026 |
| Retest by | October 5, 2028 |
| Tested by | Manufacturer’s in-house laboratory (not an independent third-party test) |
| Conclusion | Conforms |
Tests run on this lot
| Test | Method | Specification | Result |
|---|---|---|---|
| Identity (mass) | LC-MS, ESI positive | Theoretical ± 1.0 Da | 7,365.67 Da (PASS) |
| Purity | RP-HPLC, UV 214 nm, area% | ≥ 99.0% | 99.46% (PASS) |
| Largest impurity | RP-HPLC, area% | ≤ 1.0% | 0.29% (RT 13.40) (PASS) |
| Assay (label claim) | Assay vs label claim | 0.95–1.05 mg/mL | 1.00 mg/mL (PASS) |
| Bacterial endotoxin | LAL, kinetic | ≤ 5.0 EU/mg | 0.436 EU/mg (PASS) |
| Sterility | USP <71>, 14-day | No growth | No growth (PASS) |
What these results mean
HPLC purity is the share of UV-detectable material that elutes as the target compound; it is not the same as net peptide content, which also accounts for water and counter-ions. Identity means the measured mass matched the mass calculated for the compound. A certificate reports only the tests run on this lot; endotoxin, sterility and contaminant panels are not part of standard lot release. How to read a certificate of analysis.
IGF-1 DES Pen · Verify this certificate · All certificates
All IGF-1 DES Pen certificates
All products currently listed on this site are for research purposes only. Peptides are strictly for laboratory, academic, or institutional research and not for human or animal consumption. Products have not been evaluated by the U.S. Food and Drug Administration and are not intended to diagnose, treat, cure or prevent any disease.